| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50051915 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_53300 (CHEMBL663138) |
|---|
| IC50 | 15±n/a nM |
|---|
| Citation |  Gangjee, A; Vasudevan, A; Queener, SF; Kisliuk, RL 2,4-diamino-5-deaza-6-substituted pyrido[2,3-d]pyrimidine antifolates as potent and selective nonclassical inhibitors of dihydrofolate reductases. J Med Chem39:1438-46 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_LACCA | dhfR | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18437.08 |
|---|
| Organism: | Lactobacillus casei |
|---|
| Description: | ChEMBL_1357878 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
|---|
| BDBM50051915 |
|---|
| n/a |
|---|
| Name | BDBM50051915 |
|---|
| Synonyms: | CHEMBL32708 | N*6*-(2,5-Dimethoxy-benzyl)-pyrido[2,3-d]pyrimidine-2,4,6-triamine | N6-(2,5-dimethoxybenzyl)pyrido[2,3-d]pyrimidine-2,4,6-triamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H18N6O2 |
|---|
| Mol. Mass. | 326.3531 |
|---|
| SMILES | COc1ccc(OC)c(CNc2cnc3nc(N)nc(N)c3c2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
