| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50051918 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_53002 (CHEMBL664432) |
|---|
| IC50 | 79±n/a nM |
|---|
| Citation |  Gangjee, A; Vasudevan, A; Queener, SF; Kisliuk, RL 2,4-diamino-5-deaza-6-substituted pyrido[2,3-d]pyrimidine antifolates as potent and selective nonclassical inhibitors of dihydrofolate reductases. J Med Chem39:1438-46 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23891.29 |
|---|
| Organism: | Pneumocystis carinii |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
|---|
| BDBM50051918 |
|---|
| n/a |
|---|
| Name | BDBM50051918 |
|---|
| Synonyms: | CHEMBL35222 | N*6*-Methyl-N*6*-(2,3,4-trimethoxy-benzyl)-pyrido[2,3-d]pyrimidine-2,4,6-triamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N6O3 |
|---|
| Mol. Mass. | 370.4057 |
|---|
| SMILES | COc1ccc(CN(C)c2cnc3nc(N)nc(N)c3c2)c(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
