Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50051918 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_53002 (CHEMBL664432) |
---|
IC50 | 79±n/a nM |
---|
Citation | Gangjee, A; Vasudevan, A; Queener, SF; Kisliuk, RL 2,4-diamino-5-deaza-6-substituted pyrido[2,3-d]pyrimidine antifolates as potent and selective nonclassical inhibitors of dihydrofolate reductases. J Med Chem39:1438-46 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 23891.29 |
Organism: | Pneumocystis carinii |
Description: | n/a |
Residue: | 206 |
Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
BDBM50051918 |
---|
n/a |
---|
Name | BDBM50051918 |
Synonyms: | CHEMBL35222 | N*6*-Methyl-N*6*-(2,3,4-trimethoxy-benzyl)-pyrido[2,3-d]pyrimidine-2,4,6-triamine |
Type | Small organic molecule |
Emp. Form. | C18H22N6O3 |
Mol. Mass. | 370.4057 |
SMILES | COc1ccc(CN(C)c2cnc3nc(N)nc(N)c3c2)c(OC)c1OC |
Structure |
|