Reaction Details |
| Report a problem with these data |
Target | Cellular retinoic acid-binding protein 1 |
---|
Ligand | BDBM50053093 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52266 (CHEMBL665219) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Muccio, DD; Brouillette, WJ; Alam, M; Vaezi, MF; Sani, BP; Venepally, P; Reddy, L; Li, E; Norris, AW; Simpson-Herren, L; Hill, DL Conformationally defined 6-s-trans-retinoic acid analogs. 3. Structure-activity relationships for nuclear receptor binding, transcriptional activity, and cancer chemopreventive activity. J Med Chem39:3625-35 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cellular retinoic acid-binding protein 1 |
---|
Name: | Cellular retinoic acid-binding protein 1 |
Synonyms: | CRABP1 | Cellular retinoic acid-binding protein I | RABP1_CHICK | cellular retinoic acid binding protein 1 |
Type: | PROTEIN |
Mol. Mass.: | 15660.02 |
Organism: | Gallus gallus |
Description: | ChEMBL_52265 |
Residue: | 137 |
Sequence: | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKIGESFEEETVDGRKCRSLATWENENKIYCKQTLIEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE
|
|
|
BDBM50053093 |
---|
n/a |
---|
Name | BDBM50053093 |
Synonyms: | (2E,4E,6E)-8-Cyclohex-2-en-(E)-ylidene-3,7-dimethyl-octa-2,4,6-trienoic acid | CHEMBL121659 |
Type | Small organic molecule |
Emp. Form. | C16H20O2 |
Mol. Mass. | 244.3288 |
SMILES | C\C(\C=C\C=C(/C)\C=C1/CCCC=C1)=C/C(O)=O |c:12| |
Structure |
|