Reaction Details |
| Report a problem with these data |
Target | Cellular retinoic acid-binding protein 2 |
---|
Ligand | BDBM50407930 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_52400 (CHEMBL665904) |
---|
Kd | >200±n/a nM |
---|
Citation | Muccio, DD; Brouillette, WJ; Alam, M; Vaezi, MF; Sani, BP; Venepally, P; Reddy, L; Li, E; Norris, AW; Simpson-Herren, L; Hill, DL Conformationally defined 6-s-trans-retinoic acid analogs. 3. Structure-activity relationships for nuclear receptor binding, transcriptional activity, and cancer chemopreventive activity. J Med Chem39:3625-35 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cellular retinoic acid-binding protein 2 |
---|
Name: | Cellular retinoic acid-binding protein 2 |
Synonyms: | Cellular retinoic acid-binding protein II | Crabp2 | RABP2_MOUSE |
Type: | PROTEIN |
Mol. Mass.: | 15744.92 |
Organism: | Mus musculus |
Description: | ChEMBL_52402 |
Residue: | 138 |
Sequence: | MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVR
TTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGEL
ILTMTADDVVCTRVYVRE
|
|
|
BDBM50407930 |
---|
n/a |
---|
Name | BDBM50407930 |
Synonyms: | CHEMBL2111792 |
Type | Small organic molecule |
Emp. Form. | C18H24O2 |
Mol. Mass. | 272.382 |
SMILES | C/C(/C=C/C=C(/C)\C=C1/CCCC(C)=C1C)=C\C(O)=O |c:13| |
Structure |
|