| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50454329 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_46976 (CHEMBL658878) |
|---|
| Ki | 0.032000±n/a nM |
|---|
| Citation |  Huffman, JW; Yu, S; Showalter, V; Abood, ME; Wiley, JL; Compton, DR; Martin, BR; Bramblett, RD; Reggio, PH Synthesis and pharmacology of a very potent cannabinoid lacking a phenolic hydroxyl with high affinity for the CB2 receptor. J Med Chem39:3875-7 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50454329 |
|---|
| n/a |
|---|
| Name | BDBM50454329 |
|---|
| Synonyms: | CHEMBL2112647 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H38O2 |
|---|
| Mol. Mass. | 370.568 |
|---|
| SMILES | [H][C@@]12CC(CO)=CC[C@@]1([H])C(C)(C)Oc1cc(CCCCCC(C)(C)C)ccc21 |c:5| |
|---|
| Structure | 
|
|---|
Search and Browse
