Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin B
LigandBDBM50053866
Substrate/Competitorn/a
Meas. Tech.ChEMBL_47385
Ki 0.096±n/a nM
Citation Li ZOrtega-Vilain ACPatil GSChu DLForeman JEEveleth DDPowers JC Novel peptidyl alpha-keto amide inhibitors of calpains and other cysteine proteases. J Med Chem 39:4089-98 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin B
Name:Cathepsin B
Synonyms:BCSB | Cathepsin B precursor | Cathepsin B1
Type:Enzyme
Mol. Mass.:36657.87
Organism:Bos taurus (bovine)
Description:Bovine spleen CB was purchased from Sigma Co. (USA).
Residue:335
Sequence:
MWRLLATLSCLLVLTSARSSLYFPPLSDELVNFVNKQNTTWKAGHNFYNVDLSYVKKLCG
AILGGPKLPQRDAFAADVVLPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIHSNGRVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIM
AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSW
NTDWGDNGFFKILRGQDHCGIESEIVAGMPCTHQY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053866
n/a
NameBDBM50053866
Synonyms:CHEMBL131707 | Quinoline-2-carboxylic acid [1-(1-ethylaminooxalyl-propylcarbamoyl)-3-methyl-butyl]-amide
TypeSmall organic molecule
Emp. Form.C23H30N4O4
Mol. Mass.426.5087
SMILESCCNC(=O)C(=O)C(CC)NC(=O)C(CC(C)C)NC(=O)c1ccc2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: