Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50053914 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_157546 (CHEMBL764930) |
---|
Ki | 480±n/a nM |
---|
Citation | Romines, KR; Morris, JK; Howe, WJ; Tomich, PK; Horng, MM; Chong, KT; Hinshaw, RR; Anderson, DJ; Strohbach, JW; Turner, SR; Mizsak, SA Cycloalkylpyranones and cycloalkyldihydropyrones as HIV protease inhibitors: exploring the impact of ring size on structure-activity relationships. J Med Chem39:4125-30 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50053914 |
---|
n/a |
---|
Name | BDBM50053914 |
Synonyms: | 4-Hydroxy-3-(1-phenyl-propyl)-6,7,8,9-tetrahydro-5H-cyclohepta[b]pyran-2-one | CHEMBL297888 |
Type | Small organic molecule |
Emp. Form. | C19H22O3 |
Mol. Mass. | 298.3762 |
SMILES | CCC(c1ccccc1)c1c(O)c2CCCCCc2oc1=O |
Structure |
|