| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50053917 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157546 (CHEMBL764930) |
|---|
| Ki | 1100±n/a nM |
|---|
| Citation |  Romines, KR; Morris, JK; Howe, WJ; Tomich, PK; Horng, MM; Chong, KT; Hinshaw, RR; Anderson, DJ; Strohbach, JW; Turner, SR; Mizsak, SA Cycloalkylpyranones and cycloalkyldihydropyrones as HIV protease inhibitors: exploring the impact of ring size on structure-activity relationships. J Med Chem39:4125-30 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50053917 |
|---|
| n/a |
|---|
| Name | BDBM50053917 |
|---|
| Synonyms: | 4-Hydroxy-3-(1-phenyl-propyl)-5,6,7,8-tetrahydro-chromen-2-one | CHEMBL57231 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H20O3 |
|---|
| Mol. Mass. | 284.3496 |
|---|
| SMILES | CCC(c1ccccc1)c1c(O)c2CCCCc2oc1=O |
|---|
| Structure | 
|
|---|
Search and Browse
