Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50054125 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_39466 (CHEMBL653041) |
---|
IC50 | 1.9±n/a nM |
---|
Citation | Anzini, M; Cappelli, A; Vomero, S; Giorgi, G; Langer, T; Bruni, G; Romeo, MR; Basile, AS Molecular basis of peripheral vs central benzodiazepine receptor selectivity in a new class of peripheral benzodiazepine receptor ligands related to alpidem. J Med Chem39:4275-84 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50054125 |
---|
n/a |
---|
Name | BDBM50054125 |
Synonyms: | (E)-2-(2-(4-chlorophenyl)-1,2-dihydro-1-oxo-3H-pyrrolo[3,4-b]quinolin-3-ylidene-N-(4-metoxyphenyl)-N-methylacetamide | 2-[2-(4-Chloro-phenyl)-1-oxo-1,2-dihydro-pyrrolo[3,4-b]quinolin-(3E)-ylidene]-N-(4-methoxy-phenyl)-N-methyl-acetamide | CHEMBL135870 |
Type | Small organic molecule |
Emp. Form. | C27H20ClN3O3 |
Mol. Mass. | 469.919 |
SMILES | COc1ccc(cc1)N(C)C(=O)\C=C1\N(C(=O)c2cc3ccccc3nc12)c1ccc(Cl)cc1 |
Structure |
|