| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50054610 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157706 (CHEMBL763380) |
|---|
| Ki | 16±n/a nM |
|---|
| Citation |  Thaisrivongs, S; Romero, DL; Tommasi, RA; Janakiraman, MN; Strohbach, JW; Turner, SR; Biles, C; Morge, RR; Johnson, PD; Aristoff, PA; Tomich, PK; Lynn, JC; Horng, MM; Chong, KT; Hinshaw, RR; Howe, WJ; Finzel, BC; Watenpaugh, KD Structure-based design of HIV protease inhibitors: 5,6-dihydro-4-hydroxy-2-pyrones as effective, nonpeptidic inhibitors. J Med Chem39:4630-42 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50054610 |
|---|
| n/a |
|---|
| Name | BDBM50054610 |
|---|
| Synonyms: | 4-Hydroxy-6-phenethyl-3-(1-phenyl-allyl)-6-propyl-5,6-dihydro-pyran-2-one | CHEMBL143385 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28O3 |
|---|
| Mol. Mass. | 376.488 |
|---|
| SMILES | CCCC1(CCc2ccccc2)CC(=O)C(C(C=C)c2ccccc2)C(=O)O1 |
|---|
| Structure | 
|
|---|
Search and Browse
