| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50056179 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_48699 (CHEMBL657992) |
|---|
| IC50 | >1000000±n/a nM |
|---|
| Citation |  Havlícek, L; Hanus, J; Veselý, J; Leclerc, S; Meijer, L; Shaw, G; Strnad, M Cytokinin-derived cyclin-dependent kinase inhibitors: synthesis and cdc2 inhibitory activity of olomoucine and related compounds. J Med Chem40:408-12 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50056179 |
|---|
| n/a |
|---|
| Name | BDBM50056179 |
|---|
| Synonyms: | Benzyl-(7-methyl-8,9-dihydro-7H-purin-6-yl)-amine | CHEMBL133377 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H15N5 |
|---|
| Mol. Mass. | 241.2917 |
|---|
| SMILES | CN1CNc2ncnc(NCc3ccccc3)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
