Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThermolysin
LigandBDBM50056249
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210396
IC50 600±n/a nM
Citation Ksander GMde Jesus RYuan AGhai RDTrapani AMcMartin CBohacek R Ortho-substituted benzofused macrocyclic lactams as zinc metalloprotease inhibitors. J Med Chem 40:495-505 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thermolysin
Name:Thermolysin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60097.54
Organism:Bacillus thermoproteolyticus
Description:ChEMBL_1468794
Residue:548
Sequence:
MKMKMKLASFGLAAGLAAQVFLPYNALASTEHVTWNQQFQTPQFISGDLLKVNGTSPEEL
VYQYVEKNENKFKFHENAKDTLQLKEKKNDNLGFTFMRFQQTYKGIPVFGAVVTSHVKDG
TLTALSGTLIPNLDTKGSLKSGKKLSEKQARDIAEKDLVANVTKEVPEYEQGKDTEFVVY
VNGDEASLAYVVNLNFLTPEPGNWLYIIDAVDGKILNKFNQLDAAKPGDVKSITGTSTVG
VGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDA
PAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQ
TFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEI
GEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKAAYLISQGG
THYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQ
AFDAVGVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056249
n/a
NameBDBM50056249
Synonyms:(6S,9S)-6-Mercaptomethyl-7-oxo-5,6,7,8,9,10,11,12,13,14-decahydro-8-aza-benzocyclododecene-9-carboxylic acid | CHEMBL342091
TypeSmall organic molecule
Emp. Form.C17H23NO3S
Mol. Mass.321.434
SMILESOC(=O)[C@@H]1CCCCCc2ccccc2C[C@H](CS)C(=O)N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: