| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-1 receptor antagonist protein |
|---|
| Ligand | BDBM50245396 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1821475 (CHEMBL4321135) |
|---|
| IC50 | 2.0±n/a nM |
|---|
| Citation |  Talma, M; Ma?lanka, M; Mucha, A Recent developments in the synthesis and applications of phosphinic peptide analogs. Bioorg Med Chem Lett29:1031-1042 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-1 receptor antagonist protein |
|---|
| Name: | Interleukin-1 receptor antagonist protein |
|---|
| Synonyms: | ICIL-1RA | IL-1RN | IL-1ra | IL1 inhibitor | IL1F3 | IL1RA | IL1RA_HUMAN | IL1RN | INN=Anakinra | IRAP | Interleukin-1 receptor antagonist protein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 20053.78 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_118941 |
|---|
| Residue: | 177 |
|---|
| Sequence: | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL
QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD
KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
|
|
|
|---|
| BDBM50245396 |
|---|
| n/a |
|---|
| Name | BDBM50245396 |
|---|
| Synonyms: | CHEMBL4101200 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30N3O4P |
|---|
| Mol. Mass. | 455.4865 |
|---|
| SMILES | N[C@@H](CCc1ccccc1)P(O)(=O)C[C@@H](CC#C)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
