| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fucose-binding lectin PA-IIL |
|---|
| Ligand | BDBM50166886 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1823425 (CHEMBL4323189) |
|---|
| IC50 | 37000±n/a nM |
|---|
| Citation |  Sommer, R; Rox, K; Wagner, S; Hauck, D; Henrikus, SS; Newsad, S; Arnold, T; Ryckmans, T; Brönstrup, M; Imberty, A; Varrot, A; Hartmann, RW; Titz, A Anti-biofilm Agents against J Med Chem62:9201-9216 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fucose-binding lectin PA-IIL |
|---|
| Name: | Fucose-binding lectin PA-IIL |
|---|
| Synonyms: | LecB | PA-IIL |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 11857.84 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | Q9HYN5 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGS
SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
|
|---|
| BDBM50166886 |
|---|
| n/a |
|---|
| Name | BDBM50166886 |
|---|
| Synonyms: | CHEMBL195368 | methyl alpha-D-mannoside |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H14O6 |
|---|
| Mol. Mass. | 194.1825 |
|---|
| SMILES | CO[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
