Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50058021 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_202076 (CHEMBL811508) |
---|
Ki | >1000±n/a nM |
---|
Citation | Waterhouse, RN; Mardon, K; Giles, KM; Collier, TL; O'Brien, JC Halogenated 4-(phenoxymethyl)piperidines as potential radiolabeled probes for sigma-1 receptors: in vivo evaluation of [123I]-1-(iodopropen-2-yl)-4-[(4-cyanophenoxy)methyl]pip eri dine. J Med Chem40:1657-67 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50058021 |
---|
n/a |
---|
Name | BDBM50058021 |
Synonyms: | 1-Pentafluorophenylmethyl-4-pentafluorophenyloxymethyl-piperidine | CHEMBL296439 |
Type | Small organic molecule |
Emp. Form. | C19H13F10NO |
Mol. Mass. | 461.2967 |
SMILES | Fc1c(F)c(F)c(CN2CCC(COc3c(F)c(F)c(F)c(F)c3F)CC2)c(F)c1F |
Structure |
|