| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50058021 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_202076 (CHEMBL811508) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Waterhouse, RN; Mardon, K; Giles, KM; Collier, TL; O'Brien, JC Halogenated 4-(phenoxymethyl)piperidines as potential radiolabeled probes for sigma-1 receptors: in vivo evaluation of [123I]-1-(iodopropen-2-yl)-4-[(4-cyanophenoxy)methyl]pip eri dine. J Med Chem40:1657-67 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50058021 |
|---|
| n/a |
|---|
| Name | BDBM50058021 |
|---|
| Synonyms: | 1-Pentafluorophenylmethyl-4-pentafluorophenyloxymethyl-piperidine | CHEMBL296439 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H13F10NO |
|---|
| Mol. Mass. | 461.2967 |
|---|
| SMILES | Fc1c(F)c(F)c(CN2CCC(COc3c(F)c(F)c(F)c(F)c3F)CC2)c(F)c1F |
|---|
| Structure | 
|
|---|
Search and Browse
