Reaction Details |
| Report a problem with these data |
Target | Dual specificity mitogen-activated protein kinase kinase 3 |
---|
Ligand | BDBM2579 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1828615 (CHEMBL4328489) |
---|
IC50 | 17.2±n/a nM |
---|
Citation | Narayan, S; Ramisetti, S; Jaiswal, AS; Law, BK; Singh-Pillay, A; Singh, P; Amin, S; Sharma, AK ASR352, A potent anticancer agent: Synthesis, preliminary SAR, and biological activities against colorectal cancer bulk, 5-fluorouracil/oxaliplatin resistant and stem cells. Eur J Med Chem161:456-467 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity mitogen-activated protein kinase kinase 3 |
---|
Name: | Dual specificity mitogen-activated protein kinase kinase 3 |
Synonyms: | Dual specificity mitogen-activated protein kinase kinase 3 | MAP kinase kinase 3 | MAP2K3 | MAPK/ERK kinase 3 | MAPK/ERK kinase 3 (MEK3) | MAPKK 3 | MEK3 | MKK3 | MP2K3_HUMAN | PRKMK3 | SKK2 |
Type: | Protein |
Mol. Mass.: | 39321.50 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 347 |
Sequence: | MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
|
|
|
BDBM2579 |
---|
n/a |
---|
Name | BDBM2579 |
Synonyms: | (2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-29-oxa-1,7,17-triazaoctacyclo[12.12.2.1^{2,6}.0^{7,28}.0^{8,13}.0^{15,19}.0^{20,27}.0^{21,26}]nonacosa-8(13),9,11,14(28),15(19),20(27),21(26),22,24-nonaen-16-one | CHEMBL388978 | Staurosporin, 4 | Staurosporine | Staurosporine, 8 | US20240002365, Compound staurosporine | US9206188, Staurosporine | US9226923, Staurosporine |
Type | Small organic molecule |
Emp. Form. | C28H26N4O3 |
Mol. Mass. | 466.531 |
SMILES | CN[C@@H]1C[C@H]2O[C@@](C)([C@@H]1OC)n1c3ccccc3c3c4CNC(=O)c4c4c5ccccc5n2c4c13 |r| |
Structure |
|