Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50060742 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_212512 (CHEMBL817577) |
---|
Ki | 5200±n/a nM |
---|
Citation | Feng, DM; Gardell, SJ; Lewis, SD; Bock, MG; Chen, Z; Freidinger, RM; Naylor-Olsen, AM; Ramjit, HG; Woltmann, R; Baskin, EP; Lynch, JJ; Lucas, R; Shafer, JA; Dancheck, KB; Chen, IW; Mao, SS; Krueger, JA; Hare, TR; Mulichak, AM; Vacca, JP Discovery of a novel, selective, and orally bioavailable class of thrombin inhibitors incorporating aminopyridyl moieties at the P1 position. J Med Chem40:3726-33 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM50060742 |
---|
n/a |
---|
Name | BDBM50060742 |
Synonyms: | ((R)-2-{(S)-2-[(2-Amino-thiazol-4-ylmethyl)-carbamoyl]-pyrrolidin-1-yl}-1-dicyclohexylmethyl-2-oxo-ethyl)-carbamic acid tert-butyl ester | CHEMBL420334 |
Type | Small organic molecule |
Emp. Form. | C29H47N5O4S |
Mol. Mass. | 561.78 |
SMILES | CC(C)(C)OC(=O)N[C@H](C(C1CCCCC1)C1CCCCC1)C(=O)N1CCC[C@H]1C(=O)NCc1csc(N)n1 |
Structure |
|