| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50061259 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_202074 (CHEMBL811506) |
|---|
| Ki | 110.4±n/a nM |
|---|
| Citation |  Efange, SM; Kamath, AP; Khare, AB; Kung, MP; Mach, RH; Parsons, SM N-hydroxyalkyl derivatives of 3 beta-phenyltropane and 1-methylspiro[1H-indoline-3,4'-piperidine]: vesamicol analogues with affinity for monoamine transporters. J Med Chem40:3905-14 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50061259 |
|---|
| n/a |
|---|
| Name | BDBM50061259 |
|---|
| Synonyms: | 1-(4-fluorophenyl)-4-[1-methylspiro[2,3-dihydro-1H-indole-3,4'-(hexahydropyridine)]-1-yl]-1-butanone | CHEMBL405524 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H27FN2O |
|---|
| Mol. Mass. | 366.4717 |
|---|
| SMILES | CN1CC2(CCN(CCCC(=O)c3ccc(F)cc3)CC2)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
