Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(4) dopamine receptor
LigandBDBM50061349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_60661
Ki 0.31±n/a nM
Citation Unangst PCCapiris TConnor DTDoubleday RHeffner TGMacKenzie RGMiller SRPugsley TAWise LD (Aryloxy)alkylamines as selective human dopamine D4 receptor antagonists: potential antipsychotic agents. J Med Chem 40:4026-9 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(4) dopamine receptor
Name:D(4) dopamine receptor
Synonyms:D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061349
n/a
NameBDBM50061349
Synonyms:CHEMBL129534 | [2-(3-Chloro-phenoxy)-ethyl]-(3-phenoxy-propyl)-amine
TypeSmall organic molecule
Emp. Form.C17H20ClNO2
Mol. Mass.305.799
SMILESClc1cccc(OCCNCCCOc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: