| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50054156 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159973 (CHEMBL768120) |
|---|
| Ki | 0.011±n/a nM |
|---|
| Citation |  Wilkerson, WW; Dax, S; Cheatham, WW Nonsymmetrically substituted cyclic urea HIV protease inhibitors. J Med Chem40:4079-88 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50054156 |
|---|
| n/a |
|---|
| Name | BDBM50054156 |
|---|
| Synonyms: | (4r,5r,6,7)-3,3-[[Tetrahydro-5,6-dihydroxy-2-oxo-4,7-bis(phenylmethyl)-1H-1,3-diazepine-1,3(2H)-diyl]bis-methylene)]bis[N-(5-methyl-2-pyridinyl)benzamide] | 2-{3-[4,7-dibenzyl-5,6-dihydroxy-3-[3-(5-methyl-2-pyridylcarbamoyl)benzyl]-2-oxo-(4R,5S,6S,7R)-1,3-diazepan-1-ylmethyl]phenylcarboxamido}-5-methylpyridine | CHEMBL85653 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C47H46N6O5 |
|---|
| Mol. Mass. | 774.9053 |
|---|
| SMILES | Cc1ccc(NC(=O)c2cccc(CN3[C@H](Cc4ccccc4)[C@H](O)[C@@H](O)[C@@H](Cc4ccccc4)N(Cc4cccc(c4)C(=O)Nc4ccc(C)cn4)C3=O)c2)nc1 |
|---|
| Structure | 
|
|---|
Search and Browse
