Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM15236 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_212193 (CHEMBL817756) |
---|
IC50 | 10200±n/a nM |
---|
Citation | Checa, A; Ortiz, AR; de Pascual-Teresa, B; Gago, F Assessment of solvation effects on calculated binding affinity differences: trypsin inhibition by flavonoids as a model system for congeneric series. J Med Chem40:4136-45 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM15236 |
---|
n/a |
---|
Name | BDBM15236 |
Synonyms: | 3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-4H-chromen-4-one | 3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)chromen-4-one | CHEMBL164 | Cannabiscetin | Myricetin | Myricetin (20) | Myricetin (Myr) | cid_5281672 |
Type | Small organic molecule |
Emp. Form. | C15H10O8 |
Mol. Mass. | 318.2351 |
SMILES | Oc1cc(O)c2c(c1)oc(-c1cc(O)c(O)c(O)c1)c(O)c2=O |
Structure |
|