Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50061615
Substrate/Competitorn/a
Meas. Tech.ChEMBL_195493
Ki 500±n/a nM
Citation Umemiya HFukasawa HEbisawa MEyrolles LKawachi EEisenmann GGronemeyer HHashimoto YShudo KKagechika H Regulation of retinoidal actions by diazepinylbenzoic acids. Retinoid synergists which activate the RXR-RAR heterodimers. J Med Chem 40:4222-34 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoic acid receptor RXR-alpha/Retinoic acid receptor beta
Synonyms:HBV-activated protein | Nuclear receptor subfamily 1 group B member 2 | RAR-beta | RAR-epsilon | Retinoic acid receptor beta
Type:PROTEIN
Mol. Mass.:50498.70
Organism:Homo sapiens (Human)
Description:ChEMBL_1458015
Residue:455
Sequence:
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK
IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061615
n/a
NameBDBM50061615
Synonyms:4-(10,10,13,13,15-Pentamethyl-11,12,13,15-tetrahydro-10H-8,15-diaza-cyclohepta[2,1-a;4,5-b']dinaphthalen-7-yl)-benzoic acid | CHEMBL298373
TypeSmall organic molecule
Emp. Form.C33H32N2O2
Mol. Mass.488.6194
SMILESCN1c2cc3c(cc2N=C(c2ccc(cc2)C(O)=O)c2ccc4ccccc4c12)C(C)(C)CCC3(C)C |t:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: