Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50062113
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158347
Ki 0.850000±n/a nM
Citation Curtin MLDavidsen SKHeyman HRGarland RBSheppard GSFlorjancic ASXu LCarrera GMSteinman DHTrautmann JAAlbert DHMagoc TJTapang PRhein DAConway RGLuo GDenissen JFMarsh KCMorgan DWSummers JB Discovery and evaluation of a series of 3-acylindole imidazopyridine platelet-activating factor antagonists. J Med Chem 41:74-95 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062113
n/a
NameBDBM50062113
Synonyms:1-Dimethylcarbamoyl-3-[4-(2-methyl-imidazo[4,5-c]pyridin-1-ylmethyl)-benzoyl]-1H-indole-4-carboxylic acid methyl ester | CHEMBL367085
TypeSmall organic molecule
Emp. Form.C28H25N5O4
Mol. Mass.495.5292
SMILESCOC(=O)c1cccc2n(cc(C(=O)c3ccc(Cn4c(C)nc5cnccc45)cc3)c12)C(=O)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: