Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM153 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_157733 (CHEMBL765171) |
---|
Ki | 0.31±n/a nM |
---|
Citation | De Lucca, GV; Kim, UT; Liang, J; Cordova, B; Klabe, RM; Garber, S; Bacheler, LT; Lam, GN; Wright, MR; Logue, KA; Erickson-Viitanen, S; Ko, SS; Trainor, GL Nonsymmetric P2/P2' cyclic urea HIV protease inhibitors. Structure-activity relationship, bioavailability, and resistance profile of monoindazole-substituted P2 analogues. J Med Chem41:2411-23 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM153 |
---|
n/a |
---|
Name | BDBM153 |
Synonyms: | (4R,5S,6S,7R)-4,7-dibenzyl-5,6-dihydroxy-1,3-bis(naphthalen-2-ylmethyl)-1,3-diazepan-2-one | CHEMBL33647 | XK263 |
Type | n/a |
Emp. Form. | C41H38N2O3 |
Mol. Mass. | 606.752 |
SMILES | O[C@@H]1[C@@H](O)[C@@H](Cc2ccccc2)N(Cc2ccc3ccccc3c2)C(=O)N(Cc2ccc3ccccc3c2)[C@@H]1Cc1ccccc1 |
Structure |
|