| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50066914 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157879 (CHEMBL765047) |
|---|
| Ki | 81±n/a nM |
|---|
| Citation |  Alterman, M; Björsne, M; Mühlman, A; Classon, B; Kvarnström, I; Danielson, H; Markgren, PO; Nillroth, U; Unge, T; Hallberg, A; Samuelsson, B Design and synthesis of new potent C2-symmetric HIV-1 protease inhibitors. Use of L-mannaric acid as a peptidomimetic scaffold. J Med Chem41:3782-92 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50066914 |
|---|
| n/a |
|---|
| Name | BDBM50066914 |
|---|
| Synonyms: | (2R,3R,4R,5R)-2,5-Bis-benzyloxy-3,4-dihydroxy-hexanedioic acid bis-{[(3-fluoro-phenyl)-methylcarbamoyl-methyl]-amide} | CHEMBL333286 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H40F2N4O8 |
|---|
| Mol. Mass. | 718.743 |
|---|
| SMILES | CNC(=O)C(NC(=O)[C@H](OCc1ccccc1)[C@H](O)[C@@H](O)[C@@H](OCc1ccccc1)C(=O)NC(C(=O)NC)c1cccc(F)c1)c1cccc(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
