Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM348 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_157879 (CHEMBL765047) |
---|
Ki | 0.4±n/a nM |
---|
Citation | Alterman, M; Björsne, M; Mühlman, A; Classon, B; Kvarnström, I; Danielson, H; Markgren, PO; Nillroth, U; Unge, T; Hallberg, A; Samuelsson, B Design and synthesis of new potent C2-symmetric HIV-1 protease inhibitors. Use of L-mannaric acid as a peptidomimetic scaffold. J Med Chem41:3782-92 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM348 |
---|
n/a |
---|
Name | BDBM348 |
Synonyms: | (2R,3R,4R,5R)-2,5-bis(benzyloxy)-3,4-dihydroxy-N,N'-bis[(1S)-2-methyl-1-(methylcarbamoyl)propyl]hexanediamide | 1-Valine Methylamide deriv. 1 | C2-Symmetric Inhibitor 2 | C2-symmetric compound 5 | CHEMBL105459 | Diol-Based HIV-1 protease inhibitor 2 |
Type | Small organic molecule |
Emp. Form. | C32H46N4O8 |
Mol. Mass. | 614.7296 |
SMILES | CNC(=O)[C@@H](NC(=O)[C@H](OCc1ccccc1)[C@H](O)[C@@H](O)[C@@H](OCc1ccccc1)C(=O)N[C@@H](C(C)C)C(=O)NC)C(C)C |r| |
Structure |
|