Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50054124 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_200984 (CHEMBL873113) |
---|
IC50 | 0.089±n/a nM |
---|
Citation | Berardi, F; Santoro, S; Perrone, R; Tortorella, V; Govoni, S; Lucchi, L N-[omega-(Tetralin-1-yl)alkyl] derivatives of 3,3-dimethylpiperidine are highly potent and selective sigma1 or sigma2 ligands. J Med Chem41:3940-7 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50054124 |
---|
n/a |
---|
Name | BDBM50054124 |
Synonyms: | 1-[3-(5-Methoxy-1,2,3,4-tetrahydro-naphthalen-1-yl)-propyl]-3,3-dimethyl-piperidine | CHEMBL127006 |
Type | Small organic molecule |
Emp. Form. | C21H33NO |
Mol. Mass. | 315.4928 |
SMILES | COc1cccc2C(CCCN3CCCC(C)(C)C3)CCCc12 |
Structure |
|