| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50067861 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_55108 (CHEMBL665435) |
|---|
| IC50 | 1.3±n/a nM |
|---|
| Citation |  Gangjee, A; Zhu, Y; Queener, SF 6-Substituted 2,4-diaminopyrido[3,2-d]pyrimidine analogues of piritrexim as inhibitors of dihydrofolate reductase from rat liver, Pneumocystis carinii, and Toxoplasma gondii and as antitumor agents. J Med Chem41:4533-41 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50067861 |
|---|
| n/a |
|---|
| Name | BDBM50067861 |
|---|
| Synonyms: | CHEMBL140940 | N*6*-Methyl-N*6*-phenyl-pyrido[3,2-d]pyrimidine-2,4,6-triamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H14N6 |
|---|
| Mol. Mass. | 266.3012 |
|---|
| SMILES | CN(c1ccccc1)c1ccc2nc(N)nc(N)c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
