Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50067861 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_55108 (CHEMBL665435) |
---|
IC50 | 1.3±n/a nM |
---|
Citation | Gangjee, A; Zhu, Y; Queener, SF 6-Substituted 2,4-diaminopyrido[3,2-d]pyrimidine analogues of piritrexim as inhibitors of dihydrofolate reductase from rat liver, Pneumocystis carinii, and Toxoplasma gondii and as antitumor agents. J Med Chem41:4533-41 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50067861 |
---|
n/a |
---|
Name | BDBM50067861 |
Synonyms: | CHEMBL140940 | N*6*-Methyl-N*6*-phenyl-pyrido[3,2-d]pyrimidine-2,4,6-triamine |
Type | Small organic molecule |
Emp. Form. | C14H14N6 |
Mol. Mass. | 266.3012 |
SMILES | CN(c1ccccc1)c1ccc2nc(N)nc(N)c2n1 |
Structure |
|