| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM770 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159291 |
|---|
| IC50 | 3000±n/a nM |
|---|
| Citation |  Janakiraman, MN; Watenpaugh, KD; Tomich, PK; Chong, KT; Turner, SR; Tommasi, RA; Thaisrivongs, S; Strohbach, JW Non-peptidic HIV protease inhibitors: C2-symmetry-based design of bis-sulfonamide dihydropyrones. Bioorg Med Chem Lett8:1237-42 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM770 |
|---|
| n/a |
|---|
| Name | BDBM770 |
|---|
| Synonyms: | 4-hydroxy-6-(1-phenylbutan-2-yl)-3-(1-phenylpropyl)-2H-pyran-2-one | CHEMBL22164 | U-96988 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H26O3 |
|---|
| Mol. Mass. | 362.4614 |
|---|
| SMILES | CCC(Cc1ccccc1)c1cc(O)c(C(CC)c2ccccc2)c(=O)o1 |
|---|
| Structure | 
|
|---|
Search and Browse
