| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Matrilysin |
|---|
| Ligand | BDBM50064341 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_102103 |
|---|
| IC50 | 3±n/a nM |
|---|
| Citation |  Steinman, DH; Curtin, ML; Garland, RB; Davidsen, SK; Heyman, HR; Holms, JH; Albert, DH; Magoc, TJ; Nagy, IB; Marcotte, PA; Li, J; Morgan, DW; Hutchins, C; Summers, JB The design, synthesis, and structure-activity relationships of a series of macrocyclic MMP inhibitors. Bioorg Med Chem Lett8:2087-92 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Matrilysin |
|---|
| Name: | Matrilysin |
|---|
| Synonyms: | MMP7 | MMP7_HUMAN | MPSL1 | Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7) | Matrix metalloproteinase-7 (MMP7) | PUMP1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29681.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09237 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
|
|
|
|---|
| BDBM50064341 |
|---|
| n/a |
|---|
| Name | BDBM50064341 |
|---|
| Synonyms: | (6S,7R,10S)-7-Isobutyl-8-oxo-2-oxa-9-aza-bicyclo[10.2.2]hexadeca-1(15),12(16),13-triene-6,10-dicarboxylic acid 6-hydroxyamide 10-methylamide | 7-Isobutyl-8-oxo-2-oxa-9-aza-bicyclo[10.2.2]hexadeca-1(15),12(16),13-triene-6,10-dicarboxylic acid 6-hydroxyamide 10-methylamide (SE205) | CHEMBL45631 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H31N3O5 |
|---|
| Mol. Mass. | 405.4879 |
|---|
| SMILES | CNC(=O)[C@@H]1Cc2ccc(OCCC[C@@H]([C@@H](CC(C)C)C(=O)N1)C(=O)NO)cc2 |
|---|
| Structure | 
|
|---|
Search and Browse
