Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50073126 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_34109 (CHEMBL649738) |
---|
Ki | 340±n/a nM |
---|
Citation | Iijima, K; Katada, J; Yasuda, E; Uno, I; Hayashi, Y N-[2,2-dimethyl-3-(N-(4-cyanobenzoyl)amino)nonanoyl]-L-phenylalanine ethyl ester as a stable ester-type inhibitor of chymotrypsin-like serine proteases: structural requirements for potent inhibition of alpha-chymotrypsin. J Med Chem42:312-23 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50073126 |
---|
n/a |
---|
Name | BDBM50073126 |
Synonyms: | (S)-2-[3-(4-Cyano-benzoylamino)-2,2-dimethyl-nonanoylamino]-3-phenyl-propionic acid propyl ester | CHEMBL320132 |
Type | Small organic molecule |
Emp. Form. | C31H41N3O4 |
Mol. Mass. | 519.6749 |
SMILES | CCCCCCC(NC(=O)c1ccc(cc1)C#N)C(C)(C)C(=O)N[C@@H](Cc1ccccc1)C(=O)OCCC |
Structure |
|