| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Ligand | BDBM50519936 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1878748 (CHEMBL4380142) |
|---|
| Ki | 73000±n/a nM |
|---|
| Citation |  Lunk, I; Litty, FA; Hennig, S; Vetter, IR; Kotthaus, J; Altmann, KS; Ott, G; Havemeyer, A; Carrillo García, C; Clement, B; Schade, D Discovery of J Med Chem63:425-432 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Name: | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Synonyms: | DDAH | DDAH1 | DDAH1_HUMAN | Dimethylarginine dimethylaminohydrolase (DDAH-1) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) | Dimethylarginine dimethylaminohydrolase 1 (DDAH) E78A | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L271G | Dimethylarginine dimethylaminohydrolase 1 (DDAH) L30A | Dimethylarginine dimethylaminohydrolase 1 (DDAH1) | N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 31116.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O94760 |
|---|
| Residue: | 285 |
|---|
| Sequence: | MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGL
QVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
|
|
|
|---|
| BDBM50519936 |
|---|
| n/a |
|---|
| Name | BDBM50519936 |
|---|
| Synonyms: | CHEMBL4442120 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H17N3O3 |
|---|
| Mol. Mass. | 203.2389 |
|---|
| SMILES | COCC(=N)NCCC[C@H](N)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
