| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen B |
|---|
| Ligand | BDBM50075113 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_216469 (CHEMBL818539) |
|---|
| IC50 | 140±n/a nM |
|---|
| Citation |  Iijima, K; Katada, J; Hayashi, Y Symmetrical anhydride-type serine protease inhibitors: structure-activity relationship studies of human chymase inhibitors. Bioorg Med Chem Lett9:413-8 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen B |
|---|
| Name: | Chymotrypsinogen B |
|---|
| Synonyms: | Beta-chymotrypsin | CTRB | CTRB1 | CTRB1_HUMAN | Chymotrypsin B chain A | Chymotrypsin B chain B | Chymotrypsin B chain C | Chymotrypsinogen B | Synonyms=CTRB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27713.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_10909 |
|---|
| Residue: | 263 |
|---|
| Sequence: | MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
|
|
|
|---|
| BDBM50075113 |
|---|
| n/a |
|---|
| Name | BDBM50075113 |
|---|
| Synonyms: | 1,1-dimethyl-2-phenylcarboxamidopropanoic anhydride | CHEMBL134268 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28N2O5 |
|---|
| Mol. Mass. | 424.4895 |
|---|
| SMILES | CC(C)(CNC(=O)c1ccccc1)C(=O)OC(=O)C(C)(C)CNC(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
