| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N-formyl peptide receptor 2 |
|---|
| Ligand | BDBM50520824 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1882212 (CHEMBL4383711) |
|---|
| IC50 | 5.1±n/a nM |
|---|
| Citation |  de Gaetano, M; Butler, E; Gahan, K; Zanetti, A; Marai, M; Chen, J; Cacace, A; Hams, E; Maingot, C; McLoughlin, A; Brennan, E; Leroy, X; Loscher, CE; Fallon, P; Perretti, M; Godson, C; Guiry, PJ Asymmetric synthesis and biological evaluation of imidazole- and oxazole-containing synthetic lipoxin A Eur J Med Chem162:80-108 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N-formyl peptide receptor 2 |
|---|
| Name: | N-formyl peptide receptor 2 |
|---|
| Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38968.35 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25090 |
|---|
| Residue: | 351 |
|---|
| Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
|---|
| BDBM50520824 |
|---|
| n/a |
|---|
| Name | BDBM50520824 |
|---|
| Synonyms: | CHEMBL4536276 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H34N2O5 |
|---|
| Mol. Mass. | 382.4944 |
|---|
| SMILES | CCCCC[C@@H](O)c1c(\C=C\[C@@H](O)[C@@H](O)CCCC(=O)OC)nc(C)n1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
