| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 4 |
|---|
| Ligand | BDBM50247128 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1883973 (CHEMBL4385472) |
|---|
| IC50 | 7190±n/a nM |
|---|
| Citation |  Katzman, BM; Cox, BD; Prosser, AR; Alcaraz, AA; Murat, B; Héroux, M; Tebben, A; Zhang, Y; Schroeder, GM; Snyder, JP; Wilson, LJ; Liotta, DC Tetrahydroisoquinoline CXCR4 Antagonists Adopt a Hybrid Binding Mode within the Peptide Subpocket of the CXCR4 Receptor. ACS Med Chem Lett10:67-73 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 4 |
|---|
| Name: | C-X-C chemokine receptor type 4 |
|---|
| Synonyms: | C-X-C chemokine receptor type 4 | C-X-C chemokine receptor type 4 (CXCR4) | CD_antigen=CD184 | CXC-R4 | CXCR-4 | CXCR4 | CXCR4_HUMAN | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39754.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P61073 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
|
|
|
|---|
| BDBM50247128 |
|---|
| n/a |
|---|
| Name | BDBM50247128 |
|---|
| Synonyms: | (6,6-dimethyl-5,6-dihydroimidazo[2,1-b][1,3]thiazol-3-yl)methyl N,N'-dicyclohexylimidothiocarbamate | 1,3-dicyclohexyl-2-((6,6-dimethyl-5,6-dihydroimidazo[2,1-b]thiazol-3-yl)methyl)isothiourea | CHEMBL460491 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H34N4S2 |
|---|
| Mol. Mass. | 406.651 |
|---|
| SMILES | CC1(C)CN2C(CS\C(NC3CCCCC3)=N/C3CCCCC3)=CSC2=N1 |c:24,28| |
|---|
| Structure | 
|
|---|
Search and Browse
