| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50331293 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1894392 (CHEMBL4396313) |
|---|
| Ki | 554±n/a nM |
|---|
| Citation |  Thum, S; Schepmann, D; Ayet, E; Pujol, M; Nieto, FR; Ametamey, SM; Wünsch, B Tetrahydro-3-benzazepines with fluorinated side chains as NMDA and ? Eur J Med Chem177:47-62 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50331293 |
|---|
| n/a |
|---|
| Name | BDBM50331293 |
|---|
| Synonyms: | 7-methoxy-3-(4-phenylbutyl)-2,3,4,5-tetrahydro-1H-benzo[d]azepin-1-ol | CHEMBL1289403 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H27NO2 |
|---|
| Mol. Mass. | 325.4446 |
|---|
| SMILES | COc1ccc2C(O)CN(CCCCc3ccccc3)CCc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
