| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Tat |
|---|
| Ligand | BDBM50524884 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1895051 (CHEMBL4397086) |
|---|
| EC50 | 6700±n/a nM |
|---|
| Citation |  Nguyen, W; Jacobson, J; Jarman, KE; Jousset Sabroux, H; Harty, L; McMahon, J; Lewin, SR; Purcell, DF; Sleebs, BE Identification of 5-Substituted 2-Acylaminothiazoles That Activate Tat-Mediated Transcription in HIV-1 Latency Models. J Med Chem62:5148-5175 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein Tat |
|---|
| Name: | Protein Tat |
|---|
| Synonyms: | Human immunodeficiency virus type 1 Tat protein | TAT_HV1H2 | tat |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 9851.32 |
|---|
| Organism: | Human immunodeficiency virus type 1 (isolate HXB2 group M subtype B)(HIV-1) |
|---|
| Description: | ChEMBL_320712 |
|---|
| Residue: | 86 |
|---|
| Sequence: | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQ
NSQTHQASLSKQPTSQPRGDPTGPKE
|
|
|
|---|
| BDBM50524884 |
|---|
| n/a |
|---|
| Name | BDBM50524884 |
|---|
| Synonyms: | CHEMBL1386792 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H15ClN2O2 |
|---|
| Mol. Mass. | 290.745 |
|---|
| SMILES | Clc1ccc(NC(=O)CCCOc2ccccc2)nc1 |
|---|
| Structure | 
|
|---|
Search and Browse
