| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transcriptional activator protein LasR |
|---|
| Ligand | BDBM50266165 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1901852 (CHEMBL4404074) |
|---|
| IC50 | 3000±n/a nM |
|---|
| Citation |  Chbib, C Impact of the structure-activity relationship of AHL analogues on quorum sensing in Gram-negative bacteria. Bioorg Med Chem28:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Transcriptional activator protein LasR |
|---|
| Name: | Transcriptional activator protein LasR |
|---|
| Synonyms: | LASR_PSEAE | lasR |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 26618.24 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | ChEMBL_1475312 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAW
REHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHG
ARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSR
EKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLITL
|
|
|
|---|
| BDBM50266165 |
|---|
| n/a |
|---|
| Name | BDBM50266165 |
|---|
| Synonyms: | (S)-N-(2-oxotetrahydrofuran-3-yl)-2-(4-(trifluoromethyl)phenyl)acetamide | CHEMBL468624 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H12F3NO3 |
|---|
| Mol. Mass. | 287.2345 |
|---|
| SMILES | FC(F)(F)c1ccc(CC(=O)N[C@H]2CCOC2=O)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
