Reaction Details |
| Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50527147 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1902393 (CHEMBL4404615) |
---|
Ki | >40000±n/a nM |
---|
Citation | Li, G; Meanwell, NA; Krystal, MR; Langley, DR; Naidu, BN; Sivaprakasam, P; Lewis, H; Kish, K; Khan, JA; Ng, A; Trainor, GL; Cianci, C; Dicker, IB; Walker, MA; Lin, Z; Protack, T; Discotto, L; Jenkins, S; Gerritz, SW; Pendri, A Discovery and Optimization of Novel Pyrazolopyrimidines as Potent and Orally Bioavailable Allosteric HIV-1 Integrase Inhibitors. J Med Chem63:2620-2637 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50527147 |
---|
n/a |
---|
Name | BDBM50527147 |
Synonyms: | CHEMBL4592796 |
Type | Small organic molecule |
Emp. Form. | C20H23N3O3 |
Mol. Mass. | 353.4149 |
SMILES | Cc1nc2cc(nn2c(C)c1C(OC(C)(C)C)C(O)=O)-c1ccccc1 |
Structure |
|