| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 1-alkyl-2-acetylglycerophosphocholine esterase |
|---|
| Ligand | BDBM50085497 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_156348 (CHEMBL761679) |
|---|
| IC50 | 1400±n/a nM |
|---|
| Citation |  Lucas, R; Ubeda, A; Payá, M; Alves, M; del Olmo, E; López, JL; San Feliciano, A Synthesis and enzyme inhibitory activities of a series of lipidic diamine and aminoalcohol derivatives on cytosolic and secretory phospholipases A2. Bioorg Med Chem Lett10:285-8 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 1-alkyl-2-acetylglycerophosphocholine esterase |
|---|
| Name: | 1-alkyl-2-acetylglycerophosphocholine esterase |
|---|
| Synonyms: | Group VII phospholipase A2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10362.65 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_17124 |
|---|
| Residue: | 92 |
|---|
| Sequence: | ARMRTGEKYPLIIFSHGLGAFRTIYSAIGTDLASYGFIVAAVEHRDGSASATCFFKDQSA
AEIRNKTWLYLRTLGKGEEEFPLRNEQVRQRA
|
|
|
|---|
| BDBM50085497 |
|---|
| n/a |
|---|
| Name | BDBM50085497 |
|---|
| Synonyms: | 2-(ethylamino)hexadecan-1-ol | 2-Ethylamino-hexadecan-1-ol | CHEMBL89206 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H39NO |
|---|
| Mol. Mass. | 285.5084 |
|---|
| SMILES | CCCCCCCCCCCCCCC(CO)NCC |
|---|
| Structure | 
|
|---|
Search and Browse
