Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP2 subtype |
---|
Ligand | BDBM50085911 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158298 (CHEMBL763183) |
---|
IC50 | 6700±n/a nM |
---|
Citation | Wang, Y; Wos, JA; Dirr, MJ; Soper, DL; deLong, MA; Mieling, GE; De, B; Amburgey, JS; Suchanek, EG; Taylor, CJ Design and synthesis of 13,14-dihydro prostaglandin F(1alpha) analogues as potent and selective ligands for the human FP receptor. J Med Chem43:945-52 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP2 subtype |
---|
Name: | Prostaglandin E2 receptor EP2 subtype |
Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
Type: | Enzyme |
Mol. Mass.: | 39775.71 |
Organism: | Homo sapiens (Human) |
Description: | P43116 |
Residue: | 358 |
Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
BDBM50085911 |
---|
n/a |
---|
Name | BDBM50085911 |
Synonyms: | 7-{(1R,2R,3R,5S)-2-[(R)-4-(3-Chloro-phenoxy)-3-hydroxy-butyl]-3,5-dihydroxy-cyclopentyl}-heptanoic acid | 7-{2-[4-(3-Chloro-phenoxy)-3-hydroxy-butyl]-3,5-dihydroxy-cyclopentyl}-heptanoic acid | CHEMBL36041 |
Type | Small organic molecule |
Emp. Form. | C22H33ClO6 |
Mol. Mass. | 428.947 |
SMILES | O[C@H](CC[C@H]1[C@H](O)C[C@H](O)[C@@H]1CCCCCCC(O)=O)COc1cccc(Cl)c1 |
Structure |
|