Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM50086166
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30015
Ki 25.9±n/a nM
Citation Kim YCJi XMelman NLinden JJacobson KA Anilide derivatives of an 8-phenylxanthine carboxylic congener are highly potent and selective antagonists at human A(2B) adenosine receptors. J Med Chem 43:1165-72 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086166
n/a
NameBDBM50086166
Synonyms:CHEMBL275605 | N-Benzyl-2-[4-(2,6-dioxo-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purin-8-yl)-phenoxy]-acetamide | N-benzyl-2-(4-(2,6-dioxo-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purin-8-yl)phenoxy)acetamide
TypeSmall organic molecule
Emp. Form.C26H29N5O4
Mol. Mass.475.5396
SMILESCCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)-c1ccc(OCC(=O)NCc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: