Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50087063 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_70364 (CHEMBL677189) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Darula, Z; Kövér, KE; Monory, K; Borsodi, A; Makó, E; Rónai, A; Tourwé, D; Péter, A; Tóth, G Deltorphin II analogues with 6-hydroxy-2-aminotetralin-2-carboxylic acid in position 1. J Med Chem43:1359-66 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50087063 |
---|
n/a |
---|
Name | BDBM50087063 |
Synonyms: | 4-(2-{2-[(2-Amino-6-hydroxy-1,2,3,4-tetrahydro-naphthalene-2-carbonyl)-amino]-propionylamino}-3-phenyl-propionylamino)-4-{1-[1-(carbamoylmethyl-carbamoyl)-2-methyl-butylcarbamoyl]-2-methyl-butylcarbamoyl}-butyric acid | CHEMBL280848 |
Type | Small organic molecule |
Emp. Form. | C42H60N8O10 |
Mol. Mass. | 836.9734 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@]1(N)CCc2cc(O)ccc2C1)[C@@H](C)CC)C(=O)NCC(N)=O |
Structure |
|