| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50088249 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_90555 (CHEMBL699597) |
|---|
| IC50 | 6280±n/a nM |
|---|
| Citation |  Molteni, V; Rhodes, D; Rubins, K; Hansen, M; Bushman, FD; Siegel, JS A new class of HIV-1 integrase inhibitors: the 3,3,3', 3'-tetramethyl-1,1'-spirobi(indan)-5,5',6,6'-tetrol family. J Med Chem43:2031-9 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50088249 |
|---|
| n/a |
|---|
| Name | BDBM50088249 |
|---|
| Synonyms: | 5,5'-diiodo-3,3,3',3'-tetramethyl-1,1'-spirobi[2,3-dihydro-1H-indene]-6,6'-diol | CHEMBL62901 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22I2O2 |
|---|
| Mol. Mass. | 560.2071 |
|---|
| SMILES | CC1(C)CC2(CC(C)(C)c3cc(I)c(O)cc23)c2cc(O)c(I)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
