Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1/M5 chimeric protein
LigandBDBM50092313
Substrate/Competitorn/a
Meas. Tech.ChEBML_139395
Ki 1.7±n/a nM
Citation Billard WBinch HBratzler KChen LYCrosby GDuffy RADugar SLachowicz JMcQuade RPushpavanam PRuperto VBTaylor LAClader JW Diphenylsulfone muscarinic antagonists: piperidine derivatives with high M2 selectivity and improved potency. Bioorg Med Chem Lett 10:2209-12 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1/M5 chimeric protein
Name:Muscarinic acetylcholine receptor M1/M5 chimeric protein
Synonyms:Muscarinic acetylcholine receptor | Muscarinic acetylcholine receptor M5 | muscarinic acetylcholine receptor M5
Type:PROTEIN
Mol. Mass.:60102.35
Organism:Homo sapiens (Human)
Description:ChEMBL_1517990
Residue:532
Sequence:
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092313
n/a
NameBDBM50092313
Synonyms:1-Cyclohexyl-4-{1-[4-(4-methoxy-benzenesulfinyl)-phenyl]-ethyl}-piperidine | CHEMBL71124
TypeSmall organic molecule
Emp. Form.C26H35NO2S
Mol. Mass.425.627
SMILESCOc1ccc(cc1)S(=O)c1ccc(cc1)C(C)C1CCN(CC1)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: