Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B10 |
---|
Ligand | BDBM50049730 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1970370 (CHEMBL4603188) |
---|
IC50 | 39±n/a nM |
---|
Citation | Tomohara, K; Hasegawa, N; Adachi, I; Horino, Y; Nose, T Early identification of promiscuous attributes of aldose reductase inhibitors using a DMSO-perturbation assay. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B10 |
---|
Name: | Aldo-keto reductase family 1 member B10 |
Synonyms: | AK1BA_HUMAN | AKR1B10 | AKR1B11 | ARL-1 | ARP | Aldo-keto reductase family 1 member B10 | Aldo-keto reductase family 1 member B10 (AKR1B10) | Aldo-keto reductase family member 1B10 (AKR1B10) | Aldose reductase-like | Aldose reductase-related protein | SI reductase | Small intestine reductase | hARP |
Type: | Protein |
Mol. Mass.: | 36024.67 |
Organism: | Homo sapiens (Human) |
Description: | O60218. 1ZUA; 4JII; 4GQ0 |
Residue: | 316 |
Sequence: | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
|
|
|
BDBM50049730 |
---|
n/a |
---|
Name | BDBM50049730 |
Synonyms: | 2-(5-(2-methyl-3-phenylallylidene)-4-oxo-2-thioxothiazolidin-3-yl)acetic acid | CHEMBL56337 | Epalrestat | {5-[(E)-2-Methyl-3-phenyl-prop-2-en-(Z)-ylidene]-4-oxo-2-thioxo-thiazolidin-3-yl}-acetic acid |
Type | Small organic molecule |
Emp. Form. | C15H13NO3S2 |
Mol. Mass. | 319.399 |
SMILES | C\C(\C=C1/SC(=S)N(CC(O)=O)C1=O)=C/c1ccccc1 |
Structure |
|