| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50093745 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_216649 |
|---|
| IC50 | 160±n/a nM |
|---|
| Citation |  Aoyama, Y; Uenaka, M; Konoike, T; Iso, Y; Nishitani, Y; Kanda, A; Naya, N; Nakajima, M 1-Oxacephem-based human chymase inhibitors: discovery of stable inhibitors in human plasma. Bioorg Med Chem Lett10:2403-6 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50093745 |
|---|
| n/a |
|---|
| Name | BDBM50093745 |
|---|
| Synonyms: | (6R,7R)-7-(2-Ethoxy-benzoylamino)-7-methoxy-3-(1-methyl-1H-tetrazol-5-ylsulfanylmethyl)-8-oxo-5-oxa-1-aza-bicyclo[4.2.0]oct-2-ene-2-carboxylic acid 4-carboxy-benzyl ester | CHEMBL295221 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H28N6O9S |
|---|
| Mol. Mass. | 624.622 |
|---|
| SMILES | CCOc1ccccc1C(=O)N[C@@]1(OC)[C@H]2OCC(CSc3nnnn3C)=C(N2C1=O)C(=O)OCc1ccc(cc1)C(O)=O |c:28| |
|---|
| Structure | 
|
|---|
Search and Browse
