Reaction Details |
| Report a problem with these data |
Target | Corticotropin-releasing factor receptor 1 |
---|
Ligand | BDBM50096722 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_51283 |
---|
Ki | 14±n/a nM |
---|
Citation | Tian, X; Hsin, LW; Webster, EL; Contoreggi, C; Chrousos, GP; Gold, PW; Habib, K; Ayala, A; Eckelman, WC; Jacobson, AE; Rice, KC The development of a potential single photon emission computed tomography (SPECT) imaging agent for the corticotropin-releasing hormone receptor type. Bioorg Med Chem Lett11:331-3 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Corticotropin-releasing factor receptor 1 |
---|
Name: | Corticotropin-releasing factor receptor 1 |
Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 47870.75 |
Organism: | Rattus norvegicus (rat) |
Description: | Receptor binding assays were performed using rat cortex homogenate. |
Residue: | 415 |
Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
BDBM50096722 |
---|
n/a |
---|
Name | BDBM50096722 |
Synonyms: | 5-Chloro-N-cyclopropylmethyl-N'-(2,6-dichloro-4-iodo-phenyl)-2-methyl-N-propyl-pyrimidine-4,6-diamine | CHEMBL325577 |
Type | Small organic molecule |
Emp. Form. | C18H20Cl3IN4 |
Mol. Mass. | 525.642 |
SMILES | CCCN(CC1CC1)c1nc(C)nc(Nc2c(Cl)cc(I)cc2Cl)c1Cl |
Structure |
|