Reaction Details |
| Report a problem with these data |
Target | Peptide deformylase |
---|
Ligand | BDBM50099857 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_154331 |
---|
IC50 | >100000±n/a nM |
---|
Citation | Thorarensen, A; Deibel, MR; Rohrer, DC; Vosters, AF; Yem, AW; Marshall, VD; Lynn, JC; Bohanon, MJ; Tomich, PK; Zurenko, GE; Sweeney, MT; Jensen, RM; Nielsen, JW; Seest, EP; Dolak, LA Identification of novel potent hydroxamic acid inhibitors of peptidyl deformylase and the importance of the hydroxamic acid functionality on inhibition. Bioorg Med Chem Lett11:1355-8 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptide deformylase |
---|
Name: | Peptide deformylase |
Synonyms: | DEF_STAAU | PDF | Peptide Deformylase | Polypeptide deformylase | def | def1 | pdf1 |
Type: | PROTEIN |
Mol. Mass.: | 20556.80 |
Organism: | Staphylococcus aureus (strain Mu50 / ATCC 700699) |
Description: | ChEMBL_459563 |
Residue: | 183 |
Sequence: | MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA
VEV
|
|
|
BDBM50099857 |
---|
n/a |
---|
Name | BDBM50099857 |
Synonyms: | ACETOHYDROXAMIC ACID (AHA) | AHA | Acethydroxamsaeure | Acethydroxamsaure | Acetic acid, oxime | Acetylhydroxamic acid | Cetohyroxamic acid | Lithostat | Methylhydroxamic acid | N-Acetyl hydroxyacetamide | N-Acetylhydroxylamine | N-Hydroxyacetamide | acetohydroxamic acid |
Type | Small organic molecule |
Emp. Form. | C2H5NO2 |
Mol. Mass. | 75.0666 |
SMILES | CC(=O)NO |
Structure |
|