| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Eukaryotic translation initiation factor 4E |
|---|
| Ligand | BDBM50543775 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1989849 (CHEMBL4623584) |
|---|
| IC50 | 280±n/a nM |
|---|
| Citation |  Golojuch, S; Kopcial, M; Strzelecka, D; Kasprzyk, R; Baran, N; Sikorski, PJ; Kowalska, J; Jemielity, J Exploring tryptamine conjugates as pronucleotides of phosphate-modified 7-methylguanine nucleotides targeting cap-dependent translation. Bioorg Med Chem28:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Eukaryotic translation initiation factor 4E |
|---|
| Name: | Eukaryotic translation initiation factor 4E |
|---|
| Synonyms: | EIF4E | IF4E_RABIT |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25047.40 |
|---|
| Organism: | Oryctolagus cuniculus |
|---|
| Description: | ChEMBL_1511842 |
|---|
| Residue: | 217 |
|---|
| Sequence: | MATVEPETTPTPNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
|
|
|
|---|
| BDBM50543775 |
|---|
| n/a |
|---|
| Name | BDBM50543775 |
|---|
| Synonyms: | CHEMBL4640985 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H17N5O10P2S |
|---|
| Mol. Mass. | 473.293 |
|---|
| SMILES | C[n+]1cn([C@@H]2O[C@H](COP(S)(=O)OP(O)(O)=O)[C@@H](O)[C@H]2O)c2nc(N)nc([O-])c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
